PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004504259.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 228aa    MW: 26159.7 Da    PI: 9.9581
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004504259.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.72.3e-311867150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyey+
  XP_004504259.1 18 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYA 67
                    79***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.5151070IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-401069IPR002100Transcription factor, MADS-box
CDDcd002658.51E-441185No hitNo description
SuperFamilySSF554551.31E-321183IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-331232IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001266IPR002100Transcription factor, MADS-box
PfamPF003191.8E-261966IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-333247IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-334768IPR002100Transcription factor, MADS-box
PfamPF014865.9E-2792180IPR002487Transcription factor, K-box
PROSITE profilePS5129715.18496186IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MMPDSPQRKI GRGKIEIKRI ENTTNRQVTF CKRRNGLLKK AYELSVLCDA EVALIVFSTR  60
GRLYEYANNS VKASIERYKK ACSDSSGCKS ASETNAQYYQ QEAAKLRVQI SNLQNHNRQM  120
MGEALSNMSG KDLRNLETKL EKGISRIRSK KNEMLFAEIE YMQKKEIELH NSNQVLRAKI  180
SESERSQHNV NVLSGGTNFE CMQTPQQFDP RNYFQVTGLQ PNNNQYAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-201078169Myocyte-specific enhancer factor 2B
1tqe_Q4e-201078169Myocyte-specific enhancer factor 2B
1tqe_R4e-201078169Myocyte-specific enhancer factor 2B
1tqe_S4e-201078169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1598050.0KF159805.1 Medicago truncatula cultivar Jemalong A17 MADS-box transcription factor AGAMOUSb (AGb) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012572289.11e-170PREDICTED: floral homeotic protein AGAMOUS-like isoform X2
SwissprotQ408721e-122AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLG0ZMZ11e-149G0ZMZ1_VICSA; AGAMOUS
STRINGGLYMA05G29595.11e-132(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-108MIKC_MADS family protein